DARPP32 antibody (N-Term)
-
- Target See all DARPP32 (PPP1R1B) Antibodies
- DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))
-
Binding Specificity
- AA 1-36, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DARPP32 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- MDPKDRKKIQ FSVPAPPSQL DPRQVEMIRR RRPTPA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein phosphatase 1 regulatory inhibitor subunit 1B
Protein Name: Protein phosphatase 1 regulatory subunit 1B - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PPP1R1B Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- DARPP32 (PPP1R1B) (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B (PPP1R1B))
- Alternative Name
- PPP1R1B (PPP1R1B Products)
- Synonyms
- darpp32 antibody, darpp-32 antibody, Darpp-32 antibody, Darpp32 antibody, DARPP-32 antibody, DARPP32 antibody, AU040756 antibody, protein phosphatase 1 regulatory inhibitor subunit 1B antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1B antibody, protein phosphatase 1 regulatory inhibitor subunit 1B S homeolog antibody, ppp1r1b antibody, PPP1R1B antibody, Ppp1r1b antibody, ppp1r1b.S antibody
- Background
-
Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.
Synonyms: DARPP 32 antibody|DARPP-32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein 32 antibody|Dopamine and cAMP regulated neuronal phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein antibody|Dopamine and cAMP regulated phosphoprotein DARPP 32 antibody|Dopamine and cAMP regulated phosphoprotein DARPP32 antibody|Dopamine- and cAMP-regulated neuronal phosphoprotein antibody| FLJ20940 antibody|IPPD antibody|Neuronal phosphoprotein DARPP 32 antibody|PPP1R1B antibody|PPR1B_HUMAN antibody|Protein phosphatase 1 regulatory (inhibitor) subunit 1B antibody|Protein phosphatase 1 regulatory subunit 1B antibody - Gene ID
- 84152
-