MDM4-binding Protein antibody (N-Term)

Catalog No. ABIN3044527

Product Details anti-MDM4-binding Protein Antibody

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Binding Specificity: AA 35-72, N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDM4-binding Protein antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.

Sequence: KILHAAGAQG EMFTVKEVMH YLGQYIMVKQ LYDQQEQH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: MDM4, p53 regulator
Protein Name: Protein Mdm4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MDM4-binding Protein

Target: MDM4-binding Protein (MDM4) (Mdm4-binding Protein (MDM4))

Alternative Name: MDM4 (MDM4 Products)

Synonyms: mdmx antibody, HDMX antibody, MDMX antibody, MRP1 antibody, wu:fa09h09 antibody, wu:fi33d10 antibody, 4933417N07Rik antibody, AA414968 antibody, AL023055 antibody, AU018793 antibody, AU021806 antibody, C85810 antibody, Mdmx antibody, MDM4, p53 regulator S homeolog antibody, MDM4, p53 regulator antibody, transformed mouse 3T3 cell double minute 4 antibody, mdm4.S antibody, MDM4 antibody, Mdm4 antibody, mdm4 antibody

Background: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Synonyms: DKFZp781B1423 antibody|Double minute 4 antibody|Double minute 4 human homolog of p53 binding protein antibody|Double minute 4 protein antibody|HDMX antibody|MDM 4 antibody|Mdm2 like p53 binding protein antibody|Mdm2-like p53-binding protein antibody|MDM4 antibody|Mdm4 p53 binding protein homolog mouse antibody|Mdm4 protein antibody|MDM4 related protein 1 antibody|Mdm4 transformed 3T3 cell double minute 4 antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein antibody|Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse antibody|MDM4_HUMAN antibody|Mdmx protein antibody|MGC132766 antibody|Mouse double minute 4 homolog antibody| Mouse double minute 4 human homolog of p53 binding protein antibody|MRP 1 antibody|MRP1 antibody|p53 binding protein antibody|p53 BINDING PROTEIN MDM4 antibody|p53-binding protein Mdm4 antibody|Protein Mdm4 antibody|Protein Mdmx antibody

Gene ID: 4194

UniProt: O15151

Pathways: Cell Division Cycle