UBA3 antibody (C-Term)

Catalog No. ABIN3043952

Product Details anti-UBA3 Antibody

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Binding Specificity: AA 409-448, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBA3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KNRTLYLQSV TSIEERTRPN LSKTLKELGL VDGQELAVAD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ubiquitin-like modifier activating enzyme 3
Protein Name: NEDD8-activating enzyme E1 catalytic subunit

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for UBA3

Target: UBA3 (Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3))

Alternative Name: UBA3 (UBA3 Products)

Synonyms: UBE1C antibody, hUBA3 antibody, Ube1c antibody, ube1c antibody, wu:fb75e04 antibody, wu:fc37b11 antibody, zgc:55528 antibody, A830034N06Rik antibody, AI256736 antibody, AI848246 antibody, AW546539 antibody, ubiquitin like modifier activating enzyme 3 antibody, ubiquitin-like modifier activating enzyme 3 antibody, ubiquitin like modifier activating enzyme 3 S homeolog antibody, UBA3 antibody, Uba3 antibody, uba3 antibody, uba3.S antibody

Background: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Synonyms: DKFZp566J164 antibody|EC 6.3.2. antibody|hUba3 antibody|MGC22384 antibody|NEDD8 activating enzyme E1 catalytic subunit antibody|NEDD8 activating enzyme E1C antibody|Nedd8 activating enzyme hUba3 antibody|NEDD8-activating enzyme E1 catalytic subunit antibody|NEDD8-activating enzyme E1C antibody|uba3 antibody|UBA3 ubiquitin activating enzyme E1 homolog antibody|UBA3_HUMAN antibody|UBE1C antibody| Ubiquitin activating enzyme 3 antibody|Ubiquitin activating enzyme E1C antibody|Ubiquitin-activating enzyme 3 antibody|Ubiquitin-activating enzyme E1C antibody|Ubiquitin-like modifier-activating enzyme 3 antibody

Gene ID: 9039