SLC12A1 antibody (N-Term)
-
- Target See all SLC12A1 Antibodies
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
-
Binding Specificity
- AA 52-83, N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC12A1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- DEAQKRLRIS FRPGNQECYD NFLQSGETAK TD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Solute carrier family 12 member 1(SLC12A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: solute carrier family 12 (sodium/potassium/chloride transporters), member 1
Protein Name: Solute carrier family 12 member 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1(52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC12A1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse , The detection limit for SLC12A1 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))
- Alternative Name
- SLC12A1 (SLC12A1 Products)
- Synonyms
- slc12a1 antibody, SLC12A1 antibody, DKFZp469A2020 antibody, BSC1 antibody, NKCC2 antibody, Nkcc2 antibody, AI788571 antibody, D630042G03Rik antibody, mBSC1 antibody, urehr3 antibody, si:ch211-220f12.1 antibody, solute carrier family 12 member 1 antibody, solute carrier family 12, member 1 antibody, si:ch211-220f12.1 antibody, SLC12A1 antibody, Slc12a1 antibody
- Background
-
Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.
Synonyms: BSC1 antibody|Bumetanide sensitive sodium 3 antibody|Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2 antibody|Kidney specific Na K Cl symporter antibody|Kidney-specific Na-K-Cl symporter antibody|MGC48843 antibody|Na K 2Cl cotransporter antibody|NKCC2 antibody|potassiumchloride cotransporter 2 antibody|S12A1_HUMAN antibody|Slc12a1 antibody|sodium potassium chloride cotransporter 2 antibody|solute carrier family 12 (sodium/potassium/chloride transporters) antibody|Solute carrier family 12 member 1 antibody - Gene ID
- 6557
- UniProt
- Q13621
-