RAB13 antibody (C-Term)

Catalog No. ABIN3043916

Product Details anti-RAB13 Antibody

Target: RAB13 (RAB13, Member RAS Oncogene Family (RAB13))

Binding Specificity: AA 121-150, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: NKCDMEAKRK VQKEQADKLA REHGIRFFET

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ras-related protein Rab-13(RAB13) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: RAB13, member RAS oncogene family
Protein Name: Ras-related protein Rab-13

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RAB13 (121-150aa NKCDMEAKRKVQKEQADKLAREHGIRFFET), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RAB13

Target: RAB13 (RAB13, Member RAS Oncogene Family (RAB13))

Alternative Name: RAB13 (RAB13 Products)

Synonyms: cb764 antibody, hm:zeh0455 antibody, RAB13 antibody, 0610007N03Rik antibody, B230212B15Rik antibody, RAB13, member RAS oncogene family antibody, rab13 antibody, RAB13 antibody, Rab13 antibody

Background: Ras-related protein Rab-13 is a protein that in humans is encoded by the RAB13 gene. This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12.

Synonyms: Cell growth-inhibiting gene 4 protein antibody|GIG4 antibody|Growth inhibiting gene 4 protein antibody|RAB13 antibody|RAB13 member RAS oncogene family antibody|RAB13_HUMAN antibody|RAS associated protein RAB13 antibody|Ras related protein Rab13 antibody|Ras-related protein Rab-13 antibody

Gene ID: 5872

UniProt: P51153

Pathways: Cell-Cell Junction Organization