PRKAB2 antibody (N-Term)
-
- Target See all PRKAB2 Antibodies
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
-
Binding Specificity
- AA 56-89, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKAB2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- DKEFVSWQQD LEDSVKPTQQ ARPTVIRWSE GGKE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein kinase, AMP-activated, beta 2 non-catalytic subunit
Protein Name: 5'-AMP-activated protein kinase subunit beta-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PRKAB2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
- Alternative Name
- PRKAB2 (PRKAB2 Products)
- Synonyms
- prkab2 antibody, MGC64365 antibody, PRKAB2 antibody, DKFZp469M1118 antibody, 5730553K21Rik antibody, AW049591 antibody, BB124140 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog antibody, protein kinase AMP-activated non-catalytic subunit beta 2 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit antibody, prkab2.L antibody, PRKAB2 antibody, prkab2 antibody, Prkab2 antibody
- Background
-
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Synonyms: 5' AMP activated protein kinase beta 2 subunit antibody|5' AMP activated protein kinase subunit beta 2 antibody|5''-AMP-activated protein kinase subunit beta-2 antibody|AAKB2_HUMAN antibody|AMP activated protein kinase beta 2 non catalytic subunit antibody|AMPK beta 2 antibody|AMPK beta 2 chain antibody|AMPK subunit beta 2 antibody|AMPK subunit beta-2 antibody|MGC61468 antibody|PRKAB 2 antibody|Prkab2 antibody|Protein kinase AMP activated beta 2 non catalytic subunit antibody - Gene ID
- 5565
- UniProt
- O43741
- Pathways
- AMPK Signaling, Warburg Effect
-