OGT antibody (C-Term)
-
- Target See all OGT Antibodies
- OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))
-
Binding Specificity
- AA 1008-1046, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OGT antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- NTKQYTMELE RLYLQMWEHY AAGNKPDHMI KPVEVTESA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit(OGT) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: O-linked N-acetylglucosamine (GlcNAc) transferase
Protein Name: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product OGT Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- OGT (O-Linked N-Acetylglucosamine (GlcNAc) Transferase (UDP-N-Acetylglucosamine:polypeptide-N-Acetylglucosaminyl Transferase) (OGT))
- Alternative Name
- OGT (OGT Products)
- Synonyms
- BcDNA:GH04245 antibody, CG10392 antibody, Dmel\\CG10392 antibody, OGT antibody, Ogt antibody, P1201 antibody, SXC antibody, Sxc antibody, l(2)02637 antibody, l(2)NC130 antibody, sxc/Ogt antibody, fm81g08 antibody, ogt antibody, wu:fc12b01 antibody, wu:fm81g08 antibody, HRNT1 antibody, O-GLCNAC antibody, 1110038P24Rik antibody, 4831420N21Rik antibody, AI115525 antibody, Ogtl antibody, O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog antibody, super sex combs antibody, O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 antibody, O-linked N-acetylglucosamine (GlcNAc) transferase antibody, O-linked GlcNAc transferase antibody, o-linked GlcNAc transferase antibody, O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) antibody, ogt.L antibody, sxc antibody, ogt.1 antibody, OGT antibody, ogt antibody, GL50803_12081 antibody, GL50803_41701 antibody, THAPSDRAFT_264441 antibody, spyA antibody, Ogt antibody
- Background
-
O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Synonyms: FLJ23071 antibody|GlcNAc transferase antibody|HRNT1 antibody|MGC22921 antibody|O GlcNAc antibody|O GlcNAc transferase p110 subunit antibody|O GlcNAc transferase subunit p110 antibody|O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine: polypeptide N acetylglucosaminyl transferase) antibody|O linked N acetylglucosamine (GlcNAc) transferase antibody|O linked N acetylglucosamine transferase 110 kDa subunit antibody|O-GlcNAc transferase subunit p110 antibody|O-linked N-acetylglucosamine transferase 110 kDa subunit antibody|ogt antibody|OGT1_HUMAN antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit antibody|UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase antibody|UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit antibody|UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase antibody|Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase antibody - Gene ID
- 8473
- UniProt
- O15294
- Pathways
- Regulation of Carbohydrate Metabolic Process
-