MMP8 antibody (N-Term)
-
- Target See all MMP8 Antibodies
- MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
-
Binding Specificity
- AA 120-157, N-Term
-
Reactivity
- Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP8 antibody is un-conjugated
-
Application
- Western Blotting (WB), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.
- Sequence
- HTPQLSRAEV KTAIEKAFHV WSVASPLTFT EILQGEAD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Neutrophil collagenase(MMP8) detection. Tested with WB, IHC-P, ELISA in Mouse,Rat.
Gene Name: matrix metallopeptidase 8 (neutrophil collagenase)
Protein Name: Neutrophil collagenase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product MMP8 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
: "Glycyrrhizic acid alleviates bleomycin-induced pulmonary fibrosis in rats." in: Frontiers in pharmacology, Vol. 6, pp. 215, (2015) (PubMed).
: "Expression of matrix metalloproteinases-8 and -9 and their tissue inhibitor in the condyles of diabetic rats with mandibular advancement." in: Experimental and therapeutic medicine, Vol. 8, Issue 5, pp. 1357-1364, (2014) (PubMed).
: "
-
Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, (2018) (PubMed).
-
- Target
- MMP8 (Matrix Metallopeptidase 8 (Neutrophil Collagenase) (MMP8))
- Alternative Name
- MMP8 (MMP8 Products)
- Background
-
MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58 % homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57 % identity with the deduced protein sequence for fibroblast collagenase with 72 % chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.
Synonyms: CLG 1 antibody|CLG1 antibody|Collagenase 1 antibody|Collagenase 1 neutrophil antibody|HNC antibody|Matrix metallopeptidase 8 (neutrophil collagenase) antibody|Matrix metalloprotease 8 antibody|Matrix metalloproteinase-8 antibody|MMP 8 antibody|MMP-8 antibody| Mmp8 antibody| MMP8_HUMAN antibody|Neutrophil collagenase antibody|PMNL CL antibody|PMNL collagenase antibody|PMNL-CL antibody|PMNLCL antibody - Gene ID
- 17394
- UniProt
- O70138
-