Monoamine Oxidase A antibody (C-Term)

Catalog No. ABIN3043872

Product Details anti-Monoamine Oxidase A Antibody

Target: Monoamine Oxidase A (MAOA)

Binding Specificity: AA 457-493, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Monoamine Oxidase A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: REVLNGLGKV TEKDIWVQEP ESKDVPAVEI THTFWER

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: monoamine oxidase A
Protein Name: Amine oxidase [flavin-containing] A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Monoamine Oxidase A

Target: Monoamine Oxidase A (MAOA)

Alternative Name: MAOA (MAOA Products)

Synonyms: MAO-A antibody, 1110061B18Rik antibody, AA407771 antibody, Mao antibody, MAOA antibody, LOC100221249 antibody, Z-MAO antibody, maob antibody, moa antibody, wu:fb68b05 antibody, wu:fo76d11 antibody, wu:fq38g06 antibody, zgc:85761 antibody, monoamine oxidase A antibody, monoamine oxidase A L homeolog antibody, amine oxidase [flavin-containing] A antibody, monoamine oxidase antibody, MAOA antibody, Maoa antibody, maoa.L antibody, mll3668 antibody, maoa antibody, LOC100221249 antibody, mao antibody

Background: MAOA(Monoamine oxidase A), also known as AMINE OXIDASE (FLAVIN-CONTAINING) A, is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34 % in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.

Synonyms: Amine oxidase [flavin containing] A antibody|Amine oxidase [flavin-containing] A antibody|AOFA antibody|AOFA_HUMAN antibody|EC 1.4.3.4 antibody|MAO A antibody|MAO-A antibody|Maoa antibody|Monoamine oxidase A antibody|Monoamine oxidase type A antibody

Gene ID: 4128

UniProt: P21397