IKZF1 antibody (C-Term)
-
- Target See all IKZF1 Antibodies
- IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))
-
Binding Specificity
- AA 428-459, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IKZF1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros(IKZF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- LKEEHRAYDL LRAASENSQD ALRVVSTSGE QM
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for DNA-binding protein Ikaros(IKZF1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: IKAROS family zinc finger 1 (Ikaros)
Protein Name: DNA-binding protein Ikaros - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM), different from the related mouse sequence by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product IKZF1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- IKZF1 (IKAROS Family Zinc Finger 1 (Ikaros) (IKZF1))
- Alternative Name
- IKZF1 (IKZF1 Products)
- Background
-
DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.
Synonyms: CLL associated antigen KW 6 antibody|DNA-binding protein Ikaros antibody|hIk 1 antibody|Hs.54452 antibody|IK1 antibody|Ikaros (zinc finger protein) antibody|IKAROS antibody|IKAROS family zinc finger 1 (Ikaros) antibody|Ikaros family zinc finger protein 1 antibody| Ikzf1 antibody|IKZF1_HUMAN antibody|LYF1 antibody|Lymphoid transcription factor LyF-1 antibody|PRO0758 antibody|Zinc finger protein subfamily 1A 1 (Ikaros) antibody|Zinc finger protein subfamily 1A 1 antibody|Zinc finger protein, subfamily 1A, member 1 antibody| ZNFN1A1 antibody - Gene ID
- 10320
- UniProt
- Q13422
- Pathways
- Production of Molecular Mediator of Immune Response
-