Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

IDH1 antibody (C-Term)

IDH1 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043855
  • Target See all IDH1 Antibodies
    IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
    Binding Specificity
    • 16
    • 15
    • 8
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 381-413, C-Term
    Reactivity
    • 91
    • 57
    • 35
    • 7
    • 7
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 2
    • 2
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 76
    • 35
    • 3
    • 1
    Rabbit
    Clonality
    • 77
    • 38
    Polyclonal
    Conjugate
    • 63
    • 11
    • 10
    • 5
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This IDH1 antibody is un-conjugated
    Application
    • 83
    • 37
    • 35
    • 28
    • 20
    • 16
    • 13
    • 12
    • 9
    • 7
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
    Sequence
    KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
    Gene Name: isocitrate dehydrogenase 1 (NADP+), soluble
    Protein Name: Isocitrate dehydrogenase [NADP] cytoplasmic
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
    Isotype
    IgG
    Top Product
    Discover our top product IDH1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Li, Zhao, Qi, Wang, Zhang, Li, Qin: "lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." in: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).

  • Target
    IDH1 (Isocitrate Dehydrogenase 1 (NADP+), Soluble (IDH1))
    Alternative Name
    IDH1 (IDH1 Products)
    Synonyms
    IDCD antibody, IDH antibody, IDP antibody, IDPC antibody, PICD antibody, NADP-CICDH antibody, AI314845 antibody, AI788952 antibody, E030024J03Rik antibody, Id-1 antibody, Idh-1 antibody, Idpc antibody, cb876 antibody, fm90e09 antibody, im:7143416 antibody, wu:fm90e09 antibody, F23E12.180 antibody, F23E12_180 antibody, IDH-I antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 1 antibody, isocitrate dehydrogenase 1 antibody, isocitrate dehydrogenase I antibody, isocitrate dehydrogenase (NADP(+)) 1, cytosolic antibody, isocitrate dehydrogenase 1 (NADP+), soluble antibody, isocitrate dehydrogenase 1 (NADP+) L homeolog antibody, isocitrate dehydrogenase 1 antibody, IDH1 antibody, Idh1 antibody, idh1.L antibody, idh1 antibody
    Background
    Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

    Synonyms: Cytosolic NADP isocitrate dehydrogenase antibody|Cytosolic NADP-isocitrate dehydrogenase antibody|Epididymis luminal protein 216 antibody|Epididymis secretory protein Li 26 antibody|HEL-216 antibody|HEL-S-26 antibody|ICDH antibody|IDCD antibody|IDH antibody|IDH1 antibody|IDHC_HUMAN antibody|IDP antibody|IDPC antibody|Isocitrate dehydrogenase [NADP] cytoplasmic antibody|Isocitrate dehydrogenase 1 (NADP+) soluble antibody|NADP dependent isocitrate dehydrogenase cytosolic antibody|NADP dependent isocitrate dehydrogenase peroxisomal antibody|NADP(+)-specific ICDH antibody|Oxalosuccinate decarboxylase antibody|PICD antibody
    Gene ID
    3417
    UniProt
    O75874
    Pathways
    Warburg Effect
You are here:
Support