HSPA2 antibody (C-Term)

Catalog No. ABIN3043850

Product Details anti-HSPA2 Antibody

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Binding Specificity: AA 564-598, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: KISEQDKNKI LDKCQEVINW LDRNQMAEKD EYEHK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: heat shock 70 kDa protein 2
Protein Name: Heat shock-related 70 kDa protein 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HSPA2

Target: HSPA2 (Heat Shock 70kDa Protein 2 (HSPA2))

Alternative Name: HSPA2 (HSPA2 Products)

Synonyms: HSP70-2 antibody, HSP70-3 antibody, HSPA2 antibody, DKFZp468B217 antibody, 70kDa antibody, HSP70.2 antibody, HSP70A2 antibody, Hsp70-2 antibody, Hspt70 antibody, Hst70 antibody, HSPA3 antibody, heat shock protein family A (Hsp70) member 2 antibody, heat shock protein Hsp20 antibody, heat shock 70kDa protein 2 antibody, heat shock protein 2 antibody, heat shock protein family A member 2 antibody, HSPA2 antibody, hspA2 antibody, Hspa2 antibody

Background: HSPA2 (heat shock 70 kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7 % identity in the nucleotide coding sequence and 98.2 % in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.

Synonyms: 70 kDa antibody|DAQB 147D11.1 001 antibody|Hcp70.2 antibody|Heat shock 70 kDa protein 2 antibody|heat shock 70 kDa protein 1A antibody| Heat shock protein 2 antibody|heat shock protein 70 antibody|Heat shock protein 70.2 antibody|Heat shock related 70 kDa protein 2 antibody|Heat shock-related 70 kDa protein 2 antibody|Heat-shock protein, 70-KD, 2 antibody|Heat-shock protein, 70-KD, 3 antibody| HSP70 2 antibody|HSP70 3 antibody|Hsp70-2 antibody|HSP70-3 antibody|HSP70.2 antibody|HSP70A2 antibody|HSP72 antibody|HSP72_HUMAN antibody|HSPA2 antibody|Hspt70 antibody|Hst70 antibody|MGC58299 antibody|MGC7795 antibody|MGC93458 antibody|OTTHUMP00000180664 antibody|Testis-specific heat shock protein-related antibody|XXbac BCX40G17.3 001 antibody

Gene ID: 3306

UniProt: P54652