HSD11B2 antibody (C-Term)

Catalog No. ABIN3043846

Product Details anti-HSD11B2 Antibody

Target: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Binding Specificity: AA 277-309, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD11B2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EKRKQLLLAN LPQELLQAYG KDYIEHLHGQ FLH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: hydroxysteroid (11-beta) dehydrogenase 2
Protein Name: Corticosteroid 11-beta-dehydrogenase isozyme 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HSD11B2

Target: HSD11B2 (Hydroxysteroid (11-Beta) Dehydrogenase 2 (HSD11B2))

Alternative Name: HSD11B2 (HSD11B2 Products)

Synonyms: MGC81883 antibody, 11-HSD2 antibody, AME antibody, AME1 antibody, HSD11K antibody, HSD2 antibody, SDR9C3 antibody, 11HSD2 antibody, HSD11B2 antibody, hydroxysteroid (11-beta) dehydrogenase 2 L homeolog antibody, hydroxysteroid 11-beta dehydrogenase 2 antibody, hsd11b2.L antibody, HSD11B2 antibody, Hsd11b2 antibody

Background: Corticosteroid 11-β-dehydrogenase isozyme 2, also known as 11-β-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

Synonyms: 11 beta HSD2 antibody|11 beta hydroxysteroid dehydrogenase type 2 antibody|11 DH2 antibody|11-beta-HSD2 antibody|11-beta-hydroxysteroid dehydrogenase type 2 antibody|11-DH2 antibody|AME antibody|AME1 antibody|Corticosteroid 11 beta dehydrogenase isozyme 2 antibody|Corticosteroid 11-beta-dehydrogenase isozyme 2 antibody|DHI2_HUMAN antibody|HSD11B2 antibody|HSD11K antibody|HSD2 antibody| Hydroxysteroid 11 beta dehydrogenase 2 antibody|Hydroxysteroid 11 beta dehydrogenase isoenzyme 2 antibody|NAD dependent 11 beta hydroxysteroid dehydrogenase antibody|NAD-dependent 11-beta-hydroxysteroid dehydrogenase antibody|SDR9C3 antibody|Short chain dehydrogenase/reductase family 9C, member 3 antibody

Gene ID: 3291

UniProt: P80365

Pathways: Steroid Hormone Biosynthesis, Regulation of Systemic Arterial Blood Pressure by Hormones