Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ATP2A1/SERCA1 antibody (N-Term)

ATP2A1 Reactivity: Rat, Mouse WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043792
  • Target See all ATP2A1/SERCA1 (ATP2A1) Antibodies
    ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
    Binding Specificity
    • 16
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1-32, N-Term
    Reactivity
    • 37
    • 30
    • 22
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Rat, Mouse
    Host
    • 49
    • 5
    Rabbit
    Clonality
    • 47
    • 7
    Polyclonal
    Conjugate
    • 28
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This ATP2A1/SERCA1 antibody is un-conjugated
    Application
    • 40
    • 20
    • 16
    • 14
    • 14
    • 14
    • 13
    • 6
    • 3
    • 3
    • 3
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Sequence
    MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RN
    Cross-Reactivity (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Characteristics
    Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Gene Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
    Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product ATP2A1 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
    Alternative Name
    ATP2A1 (ATP2A1 Products)
    Synonyms
    cb279 antibody, serca antibody, serca1 antibody, wu:cegs655 antibody, wu:fb17h11 antibody, wu:fb19b10 antibody, zgc:92110 antibody, ATP2A1 antibody, atp2a antibody, atp2a2 antibody, atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, SERCA1 antibody, ATP2A3 antibody, SERCA1a antibody, Serca1 antibody, ATP2A antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antibody, atp2a1 antibody, ATP2A1 antibody, atp2a2.S antibody, Atp2a1 antibody
    Background
    SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

    Synonyms: fast twitch skeletal muscle isoform antibody|AT2A1_HUMAN antibody|ATP2A antibody|ATP2A1 antibody|ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody|ATPase Ca++ transporting fast twitch 1 antibody|ATPase, Ca(2+)-transporting fast twitch 1 antibody|Calcium pump 1 antibody|Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|Fast skeletal muscle SR calcium ATPase antibody|OTTHUMP00000162561 antibody|OTTHUMP00000162562 antibody|Sarcoendoplasmic reticulum calcium ATPase antibody|Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody|SERCA 1 antibody|SERCA1 antibody|SERCA1 truncated isoform, included antibody|SR Ca(2+) ATPase 1 antibody|SR Ca(2+)-ATPase 1 antibody
    Gene ID
    487
    UniProt
    O14983
    Pathways
    Ribonucleoside Biosynthetic Process
You are here:
Support