PDPK1 antibody (C-Term)
-
- Target See all PDPK1 Antibodies
- PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
-
Binding Specificity
- AA 524-556, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PDPK1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- YLMDPSGNAH KWCRKIQEVW RQRYQSHPDA AVQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 3-phosphoinositide-dependent protein kinase 1(PDPK1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: 3-phosphoinositide dependent protein kinase 1
Protein Name: 3-phosphoinositide-dependent protein kinase 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PDPK1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))
- Alternative Name
- PDPK1 (PDPK1 Products)
- Synonyms
- pdpk1 antibody, MGC82080 antibody, PDK1 antibody, PDPK2 antibody, PRO0461 antibody, Pdk1 antibody, zgc:153787 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 antibody, ATPDK1 antibody, AtPDK1 antibody, T32M21.110 antibody, T32M21_110 antibody, zgc:77318 antibody, 3-phosphoinositide dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1 L homeolog antibody, 3-phosphoinositide dependent protein kinase-1 antibody, 3-phosphoinositide dependent protein kinase 1a antibody, 3-phosphoinositide-dependent protein kinase 1 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1b antibody, PDPK1 antibody, pdpk1.L antibody, pdpk1 antibody, Pdpk1 antibody, pdpk1a antibody, LOC100380750 antibody, pdk-1 antibody, PDK1 antibody, pdpk1b antibody
- Background
-
3-phosphoinositide dependent protein kinase-1, also known as PDPK1, is a protein which in humans is encoded by the PDPK1 gene. It is mapped to 16p13.3. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.
Synonyms: 3 phosphoinositide dependent protein kinase 1 antibody|3-phosphoinositide-dependent protein kinase 1 antibody|hPDK 1 antibody|hPDK1 antibody|MGC20087 antibody|MGC35290 antibody|OTTHUMP00000159109 antibody|OTTHUMP00000159110 antibody|OTTHUMP00000174525 antibody| PDK1 antibody|Pdpk1 antibody|PDPK1_HUMAN antibody|PDPK2 antibody|PkB kinase antibody|PkB kinase like gene 1 antibody|PkB like 1 antibody|PRO0461 antibody|Protein kinase antibody - Gene ID
- 5170
- UniProt
- O15530
- Pathways
- PI3K-Akt Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
-