PAX2A antibody (C-Term)

Catalog No. ABIN3043591

Product Details anti-PAX2A Antibody

Target: PAX2A (Paired Box Gene 2a (PAX2A))

Binding Specificity: AA 248-282, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAX2A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RKHLRADTFT QQQLEALDRV FERPSYPDVF QASEH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Paired box protein Pax-2(PAX2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: paired box 2
Protein Name: Paired box protein Pax-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Pax2 (248-282aa RKHLRADTFTQQQLEALDRVFERPSYPDVFQASEH), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-PAX2A antibody (ABIN3043591)

Yang, He, Peng, Zhong, Deng, Yu, Guan, Zuo, Xu: "Matrine suppresses the migration and invasion of NSCLC cells by inhibiting PAX2-induced epithelial-mesenchymal transition." in: OncoTargets and therapy, Vol. 10, pp. 5209-5217, (2017) (PubMed).

Target Details for PAX2A

Target: PAX2A (Paired Box Gene 2a (PAX2A))

Alternative Name: PAX2 (PAX2A Products)

Synonyms: PAPRS antibody, Opdc antibody, Pax-2 antibody, Pax-2a antibody, XPax-2 antibody, XPax2 antibody, pax-2 antibody, pax2 antibody, xPax-2a antibody, PAXZF-B antibody, cb378 antibody, noi antibody, pax-b antibody, pax2.1 antibody, pax2a1 antibody, pax[zf-b] antibody, paxb antibody, pax2.2 antibody, paired box 2 antibody, paired box 2 L homeolog antibody, paired box 2a antibody, paired box 2b antibody, PAX2 antibody, Pax2 antibody, pax2.L antibody, pax2a antibody, pax2b antibody

Background: Paired box gene 2, also known as PAX2, is a protein which in humans is encoded by the PAX2 gene. This gene is mapped to 10q24. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor suppressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants.

Synonyms: Paired box 2 antibody|Paired box gene 2 antibody|paired box homeotic gene 2 antibody|paired box protein 2 antibody|Paired box protein Pax 2 antibody|Paired box protein Pax-2 antibody|Paired box protein Pax2 antibody|Pax 2 antibody

Gene ID: 5076

UniProt: Q02962

Pathways: Carbohydrate Homeostasis, Stem Cell Maintenance, Tube Formation