Parvin alpha antibody (Middle Region)

Catalog No. ABIN3043590

Product Details anti-Parvin alpha Antibody

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Binding Specificity: AA 155-185, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Parvin alpha antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QKLQTVLEKI NETLKLPPRS IKWNVDSVHA K

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Alpha-parvin(PARVA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: parvin, alpha
Protein Name: Alpha-parvin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Parvin alpha

Target: Parvin alpha (PARVA) (Parvin, alpha (PARVA))

Alternative Name: PARVA (PARVA Products)

Synonyms: CH-ILKBP antibody, MXRA2 antibody, Actp antibody, 2010012A22Rik antibody, 5430400F08Rik antibody, AI225929 antibody, AU042898 antibody, Parvin antibody, parva antibody, wu:fc59e06 antibody, zgc:101643 antibody, PARVA antibody, Parva antibody, parvin alpha antibody, parvin, alpha antibody, parvin, alpha a antibody, PARVA antibody, Parva antibody, parvaa antibody

Background: Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Synonyms: Actopaxin antibody|Alpha parvin antibody|Alpha-parvin antibody|Calponin like integrin linked kinase binding protein antibody|Calponin-like integrin-linked kinase-binding protein antibody|CH ILKBP antibody|CH-ILKBP antibody|FLJ10793 antibody|FLJ12254 antibody|Matrix remodelling associated 2 antibody|Matrix remodelling associated protein 2 antibody|Matrix-remodeling-associated protein 2 antibody|MXRA 2 antibody|MXRA2 antibody|PARV A antibody| PARVA antibody|PARVA_HUMAN antibody

Gene ID: 55742

Pathways: Smooth Muscle Cell Migration