Ataxin 2 antibody (C-Term)

Catalog No. ABIN3043507

Product Details anti-Ataxin 2 Antibody

Target: Ataxin 2 (ATXN2)

Binding Specificity: AA 1283-1313, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ataxin 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: QSALQPIPVS TTAHFPYMTH PSVQAHHQQQ L

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ataxin 2
Protein Name: Ataxin-2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Ataxin 2

Target: Ataxin 2 (ATXN2)

Alternative Name: ATXN2 (ATXN2 Products)

Synonyms: ASL13 antibody, ATX2 antibody, SCA2 antibody, TNRC13 antibody, 9630045M23Rik antibody, AW544490 antibody, Sca2 antibody, ATXN2 antibody, MGC115230 antibody, ataxin 2 antibody, ataxin 2 L homeolog antibody, ATXN2 antibody, Atxn2 antibody, atxn2.L antibody

Background: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Synonyms: Ataxin 2 antibody|ATXN2 antibody|Olivopontocerebellar ataxia 2, autosomal dominant antibody|SCA2 antibody|Spinocerebellar ataxia type 2 protein antibody|TNRC13 antibody| Trinucleotide repeat containing gene 13 protein antibody

Gene ID: 6311

UniProt: Q99700

Pathways: Ribonucleoprotein Complex Subunit Organization