POR antibody (C-Term)

Catalog No. ABIN3043443

Product Details anti-POR Antibody

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Binding Specificity: AA 633-668, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: P450 (cytochrome) oxidoreductase
Protein Name: NADPH--cytochrome P450 reductase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for POR

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Alternative Name: POR (POR Products)

Synonyms: CPR antibody, CYPOR antibody, P450R antibody, POR antibody, CCR antibody, CG11567 antibody, DMR antibody, DmCPR antibody, Dmel\\CG11567 antibody, NCPR antibody, P450 antibody, cpr antibody, zgc:110032 antibody, npr antibody, xpor antibody, 4933424M13Rik antibody, PORCINO antibody, T5J17.90 antibody, T5J17_90 antibody, TFC C antibody, TUBULIN-FOLDING COFACTOR C antibody, cytochrome p450 oxidoreductase antibody, P450 (cytochrome) oxidoreductase antibody, ADP-ribosylation factor interacting protein 2 antibody, Cytochrome P450 reductase antibody, P450 (cytochrome) oxidoreductase a antibody, P450 (cytochrome) oxidoreductase L homeolog antibody, NADPH--cytochrome P450 reductase antibody, C-CAP/cofactor C-like domain-containing protein antibody, POR antibody, Arfip2 antibody, Por antibody, Cpr antibody, pora antibody, por.L antibody, LOC100406157 antibody, por antibody, LOC100619047 antibody

Background: POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Synonyms: CPR antibody|CYPOR antibody|DKFZp686G04235 antibody|FLJ26468 antibody|NADPH Cytochrome P450 Reductase antibody|NADPH dependent cytochrome P450 reductase antibody|NADPH--cytochrome P450 reductase antibody|NCPR_HUMAN antibody|P450 (cytochrome) oxidoreductase antibody|P450 Cytochrome Oxidoreductase antibody|P450R antibody|POR antibody

Gene ID: 5447

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interactome