Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

STING/TMEM173 antibody (C-Term)

TMEM173 Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043423
  • Target See all STING/TMEM173 (TMEM173) Antibodies
    STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))
    Binding Specificity
    • 18
    • 15
    • 12
    • 8
    • 7
    • 5
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 284-316, C-Term
    Reactivity
    • 68
    • 25
    • 20
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 82
    • 4
    Rabbit
    Clonality
    • 72
    • 14
    Polyclonal
    Conjugate
    • 38
    • 8
    • 7
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This STING/TMEM173 antibody is un-conjugated
    Application
    • 50
    • 31
    • 23
    • 22
    • 13
    • 13
    • 9
    • 8
    • 8
    • 5
    • 3
    • 3
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purpose
    Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.
    Sequence
    RLEQAKLFCR TLEDILADAP ESQNNCRLIA YQE
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for Stimulator of interferon genes protein (TMEM173) detection. Tested with WB, IHC-P in Human.
    Gene Name: transmembrane protein 173
    Protein Name: Stimulator of interferon genes protein
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE), different from the related mouse sequence by five amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product TMEM173 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
    Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

    Restrictions
    For Research Use only
  • Validation #100035 (Immunohistochemistry)
    'Independent Validation' Badge
    by
    University of California, Los Angeles
    No.
    #100035
    Date
    07/02/2016
    Antigen
    Anti-TMEM173 Picoband™ Antibody
    Lot Number
    0951512Da071365
    Method validated
    Immunohistochemistry
    Positive Control
    Human pancreatic adenocarcinoma (PDAC)
    Negative Control
    Notes
    In primary human pancreatic tumor tissue, ABIN3043423 stains specifically the tumor cell cytoplasm only, not fibroblasts.
    'Independent Validation' Badge
    Validation Images
    Full Methods
    Primary Antibody
    ABIN3043423
    Secondary Antibody
    Biotin-SP-AffinPure Donkey-anti-rabbit IgG (H+L), Jackson ImmunoResearch, cat#711-065-152
    Full Protocol
    • Deparaffinize slides
      • Bake slides in oven at 60°C for 1h and let cool completely to RT.
      • Rehydrate:
      • Xylene 3x 5min
      • 100% EtOH 2x 2min
      • 95% EtOH 3x 2min
      • 70% EtOH 1x 2min
      • 50% EtOH 1x 2min
      • H2O 2x 3min
    • Blocking peroxidase activity
      • Treat in 3% H2O2-PBS for 15min on rotator at RT (240 ml/slide hold chamber).
      • Wash with PBS 3x 2min.
    • Antigen retrieval
      • Citrate buffer stock solution 100x, pH6.0 working solution 0.01M, freshly diluted into working solution.
      • Boil Citrate buffer until 100°C on hot plate, put slides in the boiled buffer, keep boiling 15min, then let them cool down on bench top for 20min.
      • Wash with H2O 2x 2min.
      • Wash with PBS 3x 5min.
      • PAP-pen cycles the slides: using vacuum to suck off the solution by cycling around the tissue area, then using the PAP-pen draw along the cycle line. Make sure the tissue area is kept wet.
    • Apply blocking solution
      • Incubate with 50-100µl (cover the whole tissue area) 5% donkey serum in PBS for 1h in moist a box at RT.
      • Blocking stock solution: 5% donkey serum in 10 ml PBS.
      • Drain blocking solution and blot excess liquid with Kim wipe.
      • Prepare primary antibody solution in blocking buffer.
    • Apply primary antibody
      • Dilute primary TMEM173 antibody ABIN3043423 1:500 dilution in 5% normal goat serum in PBS.
      • Incubate overnight in a box at 4°C to assure amoist environment and prevent slides from drying.
    • Wash with 0.05% Tween-PBS3x 5min.
    • Dilute Biotin-SP-AffinPure Donkey-anti-rabbit IgG (H+L) secondary antibody with 5% blocking solution (5% donkey serum)
    • Incubate 1h with secondary antibody at room temperature.
    • Prepare ABC solution 1:200: dilute both A and B in 0.05% Tween-PBS. Allow ABC diluted solution to sit for 30-60min before using, keep in the dark.
    • Wash with 0.05% Tween-PBS 5min, 7min, and 7min.
    • Apply 250µL/slide ABC solution; incubate for 30min at RT in moist incubation box.
    • Wash with 0.05% Tween-PBS 5min, 7min, and 7min.
    • Filter Hematoxylin.
    • Prepare fresh DAB solution in disposable beaker (do not allow solution to sit):
      • 2.5ml H2O + 1 drop buffer + 2 drops DAB + 1 drop H2O2
      • Use transfer pipette to apply DAB x 1min
    • Wash 3x with dH2O (10 dips each).
    • Hematoxylin stain 5-10sec.
    • Wash until water is clear.
    • Hematoxylin stain 5-10sec.
    • Dehydrate
      • 50% EtOH 1x 2min.
      • 70% EtOH 1x 2min.
      • 95% EtOH 2x 2min.
      • 100% EtOH 2x 2min.
      • Xylene 3x 5min.
    • Apply cover-slip. Allow glue to dry overnight.
    Experimental Notes
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))
    Alternative Name
    TMEM173 (TMEM173 Products)
    Synonyms
    ERIS antibody, MITA antibody, MPYS antibody, NET23 antibody, STING antibody, 2610307O08Rik antibody, Mita antibody, RGD1562552 antibody, transmembrane protein 173 antibody, TMEM173 antibody, Tmem173 antibody
    Background
    Transmembrane protein 173 is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.

    Synonyms: endoplasmic reticulum IFN stimulator antibody|Endoplasmic reticulum interferon stimulator antibody|ERIS antibody|FLJ38577 antibody|hMITA antibody|hSTING antibody|Mediator of IRF3 activation antibody|MITA antibody|Mitochondrial mediator of IRF3 activation antibody|MPYS antibody|N terminal methionine proline tyrosine serine plasma membrane tetraspanner antibody|NET23 antibody|Stimulator of interferon genes antibody|Stimulator of interferon genes protein antibody|STING antibody|TM173_HUMAN antibody|Tmem173 antibody|Transmembrane protein 173 antibody
    Gene ID
    340061
    Pathways
    Activation of Innate immune Response
You are here:
Support