Transferrin antibody (N-Term)

Catalog No. ABIN3043419

Product Details anti-Transferrin Antibody

Target: Transferrin (TF)

Binding Specificity: AA 20-49, N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Transferrin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: VPDKTVRWCA VSEHEATKCQ SFRDHMKSVI

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Serotransferrin(TF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: transferrin
Protein Name: Serotransferrin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Transferrin (20-49aa VPDKTVRWCAVSEHEATKCQSFRDHMKSVI), different from the related mouse and rat sequences by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Transferrin antibody (ABIN3043419)

Da, Zhuo, Qian: "MCPIP is induced by cholesterol and participated in cholesterol-caused DNA damage in HUVEC." in: International journal of clinical and experimental pathology, Vol. 8, Issue 9, pp. 10625-34, (2016) (PubMed).

Wang, Hu, Tang, Wang, Sun, Chen, Yin, Xue, Sun: "Effect Comparison of Both Iron Chelators on Outcomes, Iron Deposit, and Iron Transporters After Intracerebral Hemorrhage in Rats." in: Molecular neurobiology, (2015) (PubMed).

Liang, Zhang, Zhao, Li, Yang, Liang, Ceng: "A study of the ultrasound-targeted microbubble destruction based triplex-forming oligodexinucleotide delivery system to inhibit tissue factor expression." in: Molecular medicine reports, Vol. 11, Issue 2, pp. 903-9, (2014) (PubMed).

Chen, Li, Jiang, Zhang, Zhang, Jiang, He, Li: "Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma." in: Oncology reports, Vol. 32, Issue 2, pp. 755-63, (2014) (PubMed).

Zhu, Lv, Chen, Wang, Zhong: "Protective effect and mechanism of sodium tanshinone II A sulfonate on microcirculatory disturbance of small intestine in rats with sepsis." in: Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban, Vol. 31, Issue 4, pp. 441-5, (2011) (PubMed).

Chen, Luo, Tan, Wei, Wu, Zheng, Zhang, Xu: "Immunolocalisation of tissue factor in esophageal cancer is correlated with intratumoral angiogenesis and prognosis of the patient." in: Acta histochemica, Vol. 112, Issue 3, pp. 233-9, (2010) (PubMed).

Target Details for Transferrin

Target: Transferrin (TF)

Alternative Name: Transferrin (TF Products)

Synonyms: ltf antibody, pro1557 antibody, pro2086 antibody, mgc107777 antibody, LOC692564 antibody, TF antibody, LOC100144362 antibody, tf antibody, LTF antibody, TFEW antibody, conalbumin antibody, tf-b antibody, MGC64306 antibody, PRO1557 antibody, PRO2086 antibody, TFQTL1 antibody, AI266983 antibody, Cd176 antibody, HP antibody, Tf antibody, Tfn antibody, hpx antibody, Trf antibody, cb285 antibody, gavi antibody, id:ibd3238 antibody, id:ibd3525 antibody, sb:cb285 antibody, wu:fb57g06 antibody, wu:fb62h02 antibody, wu:fb63h10 antibody, wu:fb64h10 antibody, zgc:112154 antibody, 143958_at antibody, CG6186 antibody, Dmel\\CG6186 antibody, TSF1 antibody, anon-EST:Posey265 antibody, tsf1 antibody, Pro-TRH antibody, IL-5 antibody, STF I antibody, TRF1 antibody, sTF1 antibody, sTf antibody, tf1 antibody, transferrin antibody, serotransferrin antibody, transferrin (ovotransferrin) antibody, transferrin L homeolog antibody, melanotransferrin antibody, transferrin-a antibody, Transferrin 1 antibody, thyrotropin releasing hormone antibody, interleukin 5 antibody, TF antibody, LOC477072 antibody, tf antibody, Tf antibody, LOC100144362 antibody, tf.L antibody, LOC5575625 antibody, Trf antibody, tfa antibody, Tsf1 antibody, TRH antibody, IL5 antibody, LOC101085148 antibody, LOC100726872 antibody, trf antibody

Background: Transferrins are iron-binding blood plasma glycoproteins that control the level of free iron in biological fluids. In humans, it is encoded by the TF gene. Transferrin consists of a polypeptide chain containing 679 amino acids in humans. The protein is composed of alpha helices and beta sheets to form two domains. The N- and C- terminal sequences are represented by globular lobes and between the two lobes is an iron-binding site. Transferrin is a glycoprotein that binds iron very tightly but reversibly. Although iron bound to transferrin is less than 0.1 % (4 mg) of the total body iron, it is the most important iron pool, with the highest rate of turnover (25 mg/24 h). And Transferrin has a molecular weight of around 80 kDa and contains 2 specific high-affinity Fe(III) binding sites. The affinity of transferrin for Fe(III) is extremely high (1023 M-1 at pH 7.4) but decreases progressively with decreasing pH below neutrality.

Synonyms: Apotransferrin antibody|Beta 1 metal binding globulin antibody|Beta-1 metal-binding globulin antibody|DKFZp781D0156 antibody|PRO1400 antibody|PRO1557 antibody|PRO2086 antibody|Serotransferrin antibody|Serotransferrin precursor antibody|Siderophilin antibody|TF antibody|TFQTL1 antibody|Transferin antibody|Transferrin antibody

Gene ID: 7018

UniProt: P02787

Pathways: Transition Metal Ion Homeostasis