RAB18 antibody (C-Term)

Catalog No. ABIN3043365

Product Details anti-RAB18 Antibody

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Binding Specificity: AA 156-192, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB18 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.

Sequence: DGVQCAFEEL VEKIIQTPGL WESENQNKGV KLSHREE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ras-related protein Rab-18(RAB18) detection. Tested with WB in Human,Rat.
Gene Name: RAB18, member RAS oncogene family
Protein Name: Ras-related protein Rab-18

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab18 (156-192aa DGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREE), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RAB18

Target: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Alternative Name: RAB18 (RAB18 Products)

Synonyms: RAB18LI1 antibody, WARBM3 antibody, AA959686 antibody, RAB18 antibody, rab18li1 antibody, LOC100219058 antibody, rab18 antibody, zgc:92523 antibody, fc62e07 antibody, wu:fc62e07 antibody, zgc:77145 antibody, RAB18, member RAS oncogene family antibody, ras-related protein Rab-18-B antibody, ras-related protein Rab-18-like antibody, Ras-related protein Rab-18 antibody, RAB18, member RAS oncogene family S homeolog antibody, RAB18B, member RAS oncogene family antibody, RAB18A, member RAS oncogene family antibody, RAB18 antibody, Rab18 antibody, rab18 antibody, LOC100219058 antibody, rab-18 antibody, rab18.S antibody, rab18b antibody, rab18a antibody

Background: Ras-related protein Rab-18 is a protein that in humans is encoded by the RAB18 gene. It is a ubiquitously expressed protein with particularly high expression in the brain. The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies in zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene.

Synonyms: AA959686 antibody|RAB18 antibody|RAB18 small GTPase antibody|RAB18, member RAS oncogene family antibody|RAB18_HUMAN antibody|RAB18LI1 antibody|Ras related protein Rab 18 antibody|Ras-asssociated protein RAB18 antibody|Ras-related protein Rab-18 antibody|RP11-148B2.1 antibody|WARBM3 antibody

Gene ID: 22931

Pathways: SARS-CoV-2 Protein Interactome