PPT1 antibody (C-Term)

Catalog No. ABIN3043357

Product Details anti-PPT1 Antibody

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Binding Specificity: AA 191-224, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human,Rat.

Sequence: KEDVYRNHSI FLADINQERG INESYKKNLM ALKK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Palmitoyl-protein thioesterase 1(PPT1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: palmitoyl-protein thioesterase 1
Protein Name: Palmitoyl-protein thioesterase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for PPT1

Target: PPT1 (Palmitoyl-Protein Thioesterase 1 (PPT1))

Alternative Name: PPT1 (PPT1 Products)

Synonyms: CLN1 antibody, INCL antibody, PPT antibody, 9530043G02Rik antibody, AA960502 antibody, C77813 antibody, D4Ertd184e antibody, Ppt antibody, wu:fj17f04 antibody, zgc:63969 antibody, PPT-1 antibody, ppt1 antibody, palmitoyl-protein thioesterase 1 antibody, Palmitoyl-protein thioesterase 1 antibody, palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile) antibody, palmitoyl-protein thioesterase 1 L homeolog antibody, PPT1 antibody, MGYG_00692 antibody, Ppt1 antibody, ppt-1 antibody, ppt1 antibody, ppt1.L antibody

Background: Palmitoyl-protein thioesterase 1 (PPT-1), also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene. PPT-1 is a member of the palmitoyl protein thioesterase family. The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: Ceroid palmitoyl palmitoyl protein thioesterase 1 antibody|CLN1 antibody|EC 3.1.2.22 antibody|INCL antibody|Palmitoyl protein hydrolase 1 antibody|Palmitoyl protein thioesterase 1 antibody|Palmitoyl-protein hydrolase 1 antibody|Palmitoyl-protein thioesterase 1 antibody|PPT antibody|PPT-1 antibody|PPT1 antibody|PPT1_HUMAN antibody

Gene ID: 5538

UniProt: P50897

Pathways: SARS-CoV-2 Protein Interactome