SOX5 antibody (C-Term)
-
- Target See all SOX5 Antibodies
- SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))
-
Binding Specificity
- AA 495-528, C-Term
-
Reactivity
- Human, Rat, Mouse, Pig
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SOX5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.
- Sequence
- EKEKTTLESL TQQLAVKQNE EGKFSHAMMD FNLS
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Transcription factor SOX-5(SOX5) detection. Tested with WB in Human,Mouse,Rat,Pig.
Gene Name: SRY (sex determining region Y)-box 5
Protein Name: Transcription factor SOX-5 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SOX5 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, Pig
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SOX5 (SRY (Sex Determining Region Y)-Box 5 (SOX5))
- Alternative Name
- SOX5 (SOX5 Products)
- Background
-
Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Synonyms: L SOX5 antibody|MGC35153 antibody|Sex determining region Y box 5 antibody|SOX 5 antibody| SOX 5 protein antibody|Sox5 antibody|SOX5 protein antibody|SOX5_HUMAN antibody|SRY (sex determining region Y) box 5 antibody|SRY box 5 antibody|Transcription factor SOX 5 antibody|Transcription factor SOX-5 antibody|Transcription factor SOX5 antibody - Gene ID
- 6660
- UniProt
- P35711
-