SMC3 antibody (C-Term)
-
- Target See all SMC3 Antibodies
- SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))
-
Binding Specificity
- AA 1178-1216, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMC3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- ELLESADKFY GVKFRNKVSH IDVITAEMAK DFVEDDTTH
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: structural maintenance of chromosomes 3
Protein Name: Structural maintenance of chromosomes protein 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
- Isotype
- IgG
- Top Product
- Discover our top product SMC3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))
- Alternative Name
- SMC3 (SMC3 Products)
- Synonyms
- cspg6 antibody, xsmc3 antibody, BAM antibody, BMH antibody, CDLS3 antibody, CSPG6 antibody, HCAP antibody, SMC3L1 antibody, Bamacan antibody, Cspg6 antibody, Mmip1 antibody, SMC-3 antibody, SmcD antibody, im:7142991 antibody, wu:fb22e01 antibody, wu:fc30d07 antibody, bamacan antibody, structural maintenance of chromosomes 3 antibody, structural maintenance of chromosomes 3 S homeolog antibody, smc3 antibody, SMC3 antibody, Smc3 antibody, smc3.S antibody
- Background
-
Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
Synonyms: BAM antibody|Bamacan antibody|Basement membrane associated chondroitin proteoglycan antibody|Basement membrane-associated chondroitin proteoglycan antibody|BMH antibody|CDLS3 antibody|chondroitin sulfate proteoglycan 6 (bamacan) antibody|Chondroitin sulfate proteoglycan 6 antibody|Chromosome associated polypeptide antibody|Chromosome-associated polypeptide antibody|CSPG 6 antibody|CSPG6 antibody|hCAP antibody|SMC 3 antibody|SMC protein 3 antibody|SMC-3 antibody|smc3 antibody|SMC3_HUMAN antibody|SMC3L1 antibody| Structural maintenance of chromosome 3 antibody|Structural maintenance of chromosomes 3 antibody|Structural maintenance of chromosomes protein 3 antibody - Gene ID
- 9126
- Pathways
- Stem Cell Maintenance
-