RUNX1 antibody (Middle Region)

Catalog No. ABIN3043318

Product Details anti-RUNX1 Antibody

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Binding Specificity: AA 200-233, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: ELEQLRRTAM RVSPHHPAPT PNPRASLNHS TAFN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Runt-related transcription factor 1(RUNX1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: runt-related transcription factor 1
Protein Name: Runt-related transcription factor 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RUNX1(200-233aa ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for RUNX1 is approximately 0.25 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-RUNX1 antibody (ABIN3043318)

Du, Li, Zhong, Fan, Qiao, He, Fu, Wang, Ye: "Brain death induces the alteration of liver protein expression profiles in rabbits." in: International journal of molecular medicine, Vol. 34, Issue 2, pp. 578-84, (2014) (PubMed).

Target Details for RUNX1

Target: RUNX1 (Runt-Related Transcription Factor 1 (RUNX1))

Alternative Name: RUNX1 (RUNX1 Products)

Synonyms: RUNX1 antibody, runx1 antibody, AI462102 antibody, AML1 antibody, Cbfa2 antibody, Pebp2a2 antibody, Pebpa2b antibody, AML1-EVI-1 antibody, AMLCR1 antibody, CBFA2 antibody, EVI-1 antibody, PEBP2aB antibody, runxa antibody, Runx-1 antibody, XAML antibody, Xaml1 antibody, aml antibody, aml-1 antibody, aml1 antibody, aml1-evi-1 antibody, amlcr1 antibody, cbfa2 antibody, evi-1 antibody, pebp2ab antibody, Aml1 antibody, uncharacterized LOC473981 antibody, runt-related transcription factor antibody, runt related transcription factor 1 antibody, runt-related transcription factor 1 antibody, runt related transcription factor 1 L homeolog antibody, LOC473981 antibody, runt antibody, Runx1 antibody, RUNX1 antibody, runx1 antibody, runx1.L antibody

Background: Runt-related transcription factor 1 (RUNX1), also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene. It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-α (CBFα). RUNX1 is mapped to 21q22.12. RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells. RUNX proteins form a heterodimeric complex with CBFβ which confers increased DNA binding and stability to the complex. Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia including M2 AML. Mutations in RUNX1 are implicated in cases of breast cancer.

Synonyms: Acute myeloid leukemia 1 antibody|Acute myeloid leukemia 1 protein antibody|alpha subunit antibody|alpha subunit core binding factor antibody|AML 1 antibody|AML1 antibody|AML1 EVI 1 antibody|AML1 EVI 1 fusion protein antibody|Aml1 oncogene antibody|AMLCR 1 antibody|AMLCR1 antibody|CBF alpha 2 antibody|CBF-alpha-2 antibody|CBFA 2 antibody|CBFA2 antibody|Core binding factor alpha 2 subunit antibody|Core binding factor runt domain alpha subunit 2 antibody|Core-binding factor subunit alpha-2 antibody|EVI 1 antibody|EVI1 antibody|Oncogene AML 1 antibody|Oncogene AML-1 antibody|OTTHUMP00000108696 antibody|OTTHUMP00000108697 antibody|OTTHUMP00000108699 antibodyOTTHUMP00000108700 antibody|OTTHUMP00000108702 antibody|PEA2 alpha B antibody|PEA2-alpha B antibody|PEBP2 alpha B antibody|PEBP2-alpha B antibody|PEBP2A2 antibody|PEBP2aB antibody|Polyomavirus enhancer binding protein 2 alpha B subunit antibody|Polyomavirus enhancer-binding protein 2 alpha B subunit antibody|Run1 antibody|Runt related transcription factor 1 antibody|Runt-related transcription factor 1 antibody|RUNX 1 antibody|Runx1 antibody|RUNX1_HUMAN antibody|SL3 3 enhancer factor 1 alpha B subunit antibody|SL3-3 enhancer factor 1 alpha B subunit antibody|SL3/AKV core binding factor alpha B subunit antibody|SL3/AKV core-binding factor alpha B subunit antibody

Gene ID: 861

UniProt: Q01196