LCAT antibody (C-Term)
-
- Target See all LCAT Antibodies
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
-
Binding Specificity
- AA 389-423, C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LCAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase(LCAT) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- QPVHLLPMNE TDHLNMVFSN KTLEHINAIL LGAYR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase(LCAT) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: lecithin-cholesterol acyltransferase
Protein Name: Phosphatidylcholine-sterol acyltransferase - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LCAT Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LCAT (Lecithin-Cholesterol Acyltransferase (LCAT))
- Alternative Name
- LCAT (LCAT Products)
- Synonyms
- AI046659 antibody, D8Wsu61e antibody, MGC82035 antibody, lcat antibody, MGC88964 antibody, LCAT antibody, lecithin-cholesterol acyltransferase antibody, lecithin cholesterol acyltransferase antibody, lecithin-cholesterol acyltransferase L homeolog antibody, solute carrier family 12 member 4 antibody, fragile site, aphidicolin type, common, fra(13)(q13.2) antibody, LCAT antibody, Lcat antibody, lcat.L antibody, lcat antibody, SLC12A4 antibody, FRA13A antibody
- Background
-
LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
Synonyms: LCAT antibody|LCAT_HUMAN antibody|Lecithin cholesterol acyltransferase antibody|Lecithin-cholesterol acyltransferase antibody| Phosphatidylcholine sterol acyltransferase antibody| Phosphatidylcholine-sterol acyltransferase antibody|Phospholipid cholesterol acyltransferase antibody|Phospholipid-cholesterol acyltransferase antibody - Gene ID
- 16816
- UniProt
- P16301
- Pathways
- Lipid Metabolism
-