Nibrin antibody (C-Term)

Catalog No. ABIN3043282

Product Details anti-Nibrin Antibody

Target: Nibrin (NBN)

Binding Specificity: AA 714-745, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nibrin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: RKNTELEEWL RQEMEVQNQH AKEESLADDL FR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: nibrin
Protein Name: Nibrin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Nibrin

Target: Nibrin (NBN)

Alternative Name: NBN (NBN Products)

Synonyms: NBN antibody, AT-V1 antibody, AT-V2 antibody, ATV antibody, NBS antibody, NBS1 antibody, P95 antibody, Nbs1 antibody, im:6911679 antibody, zgc:194152 antibody, nibrin antibody, NBN antibody, nbn antibody, Nbn antibody

Background: P95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).

Synonyms: AT V1 antibody|AT V2 antibody|ATV antibody|ATV antibody|Cell cycle regulatory protein p95 antibody|FLJ10155 antibody|MGC87362 antibody|NBN antibody|NBN_HUMAN antibody|NBS 1 antibody|NBS antibody|NBS antibody|NBS1 antibody|Nibrin antibody|Nibrin antibody| Nijmegen breakage syndrome 1 (nibrin) antibody|Nijmegen breakage syndrome antibody|Nijmegen breakage syndrome protein 1 antibody|p95 antibody|p95 antibody|p95 protein of the MRE11/RAD50 complex antibody

Gene ID: 4683

UniProt: O60934

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response