CRY2 antibody (N-Term)
-
- Target See all CRY2 Antibodies
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
-
Binding Specificity
- AA 171-200, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRY2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- RFQAIISRME LPKKPVGLVT SQQMESCRAE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cryptochrome-2(CRY2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cryptochrome circadian clock 2
Protein Name: Cryptochrome-2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human CRY2 (171-200aa RFQAIISRMELPKKPVGLVTSQQMESCRAE), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CRY2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CRY2 (Cryptochrome 2 (Photolyase-Like) (CRY2))
- Alternative Name
- CRY2 (CRY2 Products)
- Synonyms
- Cry2 antibody, Cry antibody, GB10211 antibody, CRY2 antibody, AT-PHH1 antibody, ATCRY2 antibody, CRYPTOCHROME 2 APOPROTEIN antibody, F19P19.14 antibody, F19P19_14 antibody, FHA antibody, PHH1 antibody, cryptochrome 2 antibody, HCRY2 antibody, PHLL2 antibody, AV006279 antibody, D130054K12Rik antibody, gCry2 antibody, cryptochrome circadian regulator 2 antibody, cryptochrome 2 antibody, cryptochrome Cry2 antibody, cryptochrome circadian clock 2 antibody, cryptochrome 2 (photolyase-like) antibody, CRY2 antibody, Cry2 antibody, cry2 antibody, LOC100502533 antibody
- Background
-
This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. And it is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene have been associated with altered sleep patterns. The encoded protein is widely conserved across plants and animals. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms: cry2 antibody|CRY2_HUMAN antibody|cryptochrome 2 (photolyase like) antibody|Cryptochrome 2 antibody|Cryptochrome-2 antibody|FLJ10332 antibody|growth inhibiting protein 37 antibody|HCRY2 antibody|KIAA0658 antibody|PHLL2 antibody|Photolyase like antibody - Gene ID
- 1408
- Pathways
- Response to Water Deprivation, Protein targeting to Nucleus
-