HTR2A antibody (C-Term)
-
- Target See all HTR2A Antibodies
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
-
Binding Specificity
- AA 400-431, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HTR2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
- Sequence
- KENKKPLQLI LVNTIPALAY KSSQLQMGQK KN
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human,Rat.
Gene Name: 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled
Protein Name: 5-hydroxytryptamine receptor 2A - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product HTR2A Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HTR2A (5-Hydroxytryptamine (serotonin) Receptor 2A (HTR2A))
- Alternative Name
- HTR2A (HTR2A Products)
- Synonyms
- 5-HT2A antibody, HTR2 antibody, 5-HT-2 antibody, 5-HT-2A antibody, 5-HTR2A antibody, LOC100009461 antibody, E030013E04 antibody, Htr-2 antibody, Htr2 antibody, 5Ht-2 antibody, 5HT2A antibody, 5HTR2A antibody, HTR2A antibody, Htr2a antibody, 5HT2 antibody, 5-hydroxytryptamine receptor 2A antibody, 5-hydroxytryptamine (serotonin) receptor 2A antibody, HTR2A antibody, Htr2a antibody
- Background
-
The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones. 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.
Synonyms: 5 HT 2 antibody|5 HT 2A antibody|5 HT2 receptor antibody|5 HT2A antibody|5 hydroxytryptamine receptor 2A antibody|5-HT-2 antibody|5-HT-2A antibody|5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody|5-hydroxytryptamine 2A receptor antibody|5-hydroxytryptamine receptor 2A antibody|5HT2A_HUMAN antibody|HTR 2 antibody|HTR 2A antibody|HTR2 antibody|HTR2, formerly antibody|HTR2A antibody|serotonin 5-HT-2 receptor, formerly antibody|serotonin 5-HT-2A receptor antibody|Serotonin receptor 2A antibody - Gene ID
- 3356
- UniProt
- P28223
- Pathways
- JAK-STAT Signaling, Inositol Metabolic Process, Regulation of Carbohydrate Metabolic Process
-