SP5 antibody (Middle Region)

Catalog No. ABIN3042490

Product Details anti-SP5 Antibody

Target: SP5 (Sp5 Transcription Factor (SP5))

Binding Specificity: AA 246-275, Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SP5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.

Sequence: DFAQYQSQIA ALLQTKAPLA ATARRCRRCR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.
Gene Name: Sp5 transcription factor
Protein Name: Transcription factor Sp5

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Sp5 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for SP5

Target: SP5 (Sp5 Transcription Factor (SP5))

Alternative Name: SP5 (SP5 Products)

Synonyms: bts1 antibody, fc39b01 antibody, wu:fc39b01 antibody, Bricd6 antibody, SP-C antibody, SP5 antibody, SPC antibody, Sftp-2 antibody, Sftp2 antibody, pro-SpC antibody, Sp5 transcription factor antibody, Sp5 transcription factor a antibody, surfactant associated protein C antibody, trans-acting transcription factor 5 antibody, Sp5 antibody, sp5a antibody, SP5 antibody, CpipJ_CPIJ003609 antibody, Sftpc antibody

Background: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Synonyms: Transcription factor Sp5 antibody

Gene ID: 389058