IRF2 antibody (C-Term)
-
- Target See all IRF2 Antibodies
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
-
Binding Specificity
- AA 317-348, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IRF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
- Sequence
- MTPASSSSRP DRETRASVIK KTSDITQARV KS
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Interferon regulatory factor 2(IRF2) detection. Tested with WB in Human,Rat.
Gene Name: interferon regulatory factor 2
Protein Name: Interferon regulatory factor 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human IRF2 (317-348aa MTPASSSSRPDRETRASVIKKTSDITQARVKS), different from the related mouse sequence by three amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product IRF2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- IRF2 (Interferon Regulatory Factor 2 (IRF2))
- Alternative Name
- IRF2 (IRF2 Products)
- Synonyms
- IRF-2 antibody, 9830146E22Rik antibody, AI646973 antibody, Irf-2 antibody, irf2b antibody, zgc:103451 antibody, irf-2 antibody, wu:fc74h04 antibody, zgc:76951 antibody, interferon regulatory factor 2 antibody, interferon regulatory factor 2 L homeolog antibody, interferon regulatory factor 2a antibody, IRF2 antibody, Irf2 antibody, irf2 antibody, irf2.L antibody, irf2a antibody
- Background
-
IRF2 (interferon regulatory factor 2) is a member of the interferon regulatory transcription factor (IRF) family. The IRF2 gene is mapped on 4q35.1. When the IRF2 gene was overexpressed in NIH 3T3 cells, the cells became transformed and displayed enhanced tumorigenicity in nude mice. One IRF binding site was found within the IRF2 promoter, and expression of the IRF2 gene was affected by both transient and stable IRF1 expression. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. Irf2 was required to prevent NK-cell apoptosis and keep immature NK cells alive, thus promoting NK-cell maturation and their supply to peripheral blood.
Synonyms: DKFZp686F0244 antibody|Interferon regulatory factor 2 antibody|IRF 2 antibody|IRF-2 antibody|IRF2 antibody|IRF2_HUMAN antibody - Gene ID
- 3660
- UniProt
- P14316
-