HMGB3 antibody (N-Term)

Catalog No. ABIN3042447

Product Details anti-HMGB3 Antibody

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Binding Specificity: AA 62-95, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HMGB3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: high mobility group box 3
Protein Name: High mobility group protein B3

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Alternative Name: HMGB3 (HMGB3 Products)

Synonyms: HMG-2a antibody, HMG-4 antibody, HMG2A antibody, HMG4 antibody, Hmg2a antibody, Hmg4 antibody, RGD1564407 antibody, hmgb3 antibody, MGC54022 antibody, Xhmgb3 antibody, MGC88931 antibody, fa19b06 antibody, fj43d02 antibody, wu:fa19b06 antibody, wu:fj43d02 antibody, zgc:112073 antibody, HMGB3 antibody, NFD03 antibody, NFD3 antibody, NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR antibody, high mobility group B3 antibody, HMG-1 antibody, HMG2a antibody, HMGB1 antibody, high mobility group box 3 antibody, high mobility group box 3b antibody, high mobility group box 3 S homeolog antibody, high mobility group protein antibody, high mobility group B3 antibody, High mobility group protein B3 antibody, HMGB3 antibody, Hmgb3 antibody, hmgb3 antibody, hmgb3b antibody, hmgb3.S antibody

Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Synonyms: chromosomal protein, Nonhistone, HMG4 antibody|High mobility group (nonhistone chromosomal) protein 4 antibody|High mobility group box 3 antibody|High mobility group protein 2a antibody|High mobility group protein 4 antibody|High mobility group protein B3 antibody| High mobility group protein HMG4 antibody|HMG 4 antibody|HMG-2a antibody|HMG-4 antibody|HMG2A antibody|HMGB 3 antibody|HMGB3 antibody| HMGB3_HUMAN antibody|MGC90319 antibody|Non histone chromosomal protein antibody|Nonhistone chromosomal protein HMG4 antibody

Gene ID: 3149

UniProt: O15347