FUT1 antibody (N-Term)
-
- Target See all FUT1 Antibodies
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
-
Binding Specificity
- AA 134-164, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FUT1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
- Sequence
- EVDSRTPWRE LQLHDWMSEE YADLRDPFLK L
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human,Mouse, Rat.
Gene Name: fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Protein Name: Galactoside 2-alpha-L-fucosyltransferase 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FUT1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FUT1 (Fucosyltransferase 1 (Galactoside 2-alpha-L-Fucosyltransferase, H Blood Group) (FUT1))
- Alternative Name
- FUT1 (FUT1 Products)
- Synonyms
- Futa antibody, H antibody, HH antibody, HSC antibody, Fut1 antibody, fucosyltransferase 1 antibody, fucosyltransferase 1 (H blood group) antibody, Fut1 antibody, FUT1 antibody
- Background
-
Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1 gene. It is mapped to 19q13.3. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Synonyms: 2)FT 1 antibody|2-alpha-L-fucosyltransferase antibody|Alpha (1 2) fucosyltransferase antibody|Alpha(1 2)FT 1 antibody|Alpha(1 antibody|Blood group H alpha 2-fucosyltransferase antibody|fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) antibody| Fucosyltransferase 1 antibody|FUT1 antibody|FUT1_HUMAN antibody|Galactoside 2 alpha L fucosyltransferase antibody|Galactoside 2-alpha-L-fucosyltransferase 1 antibody|GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 antibody|H antibody|HH antibody| HSC antibody|Para Bombay phenotype antibody - Gene ID
- 2523
- UniProt
- P19526
-