FOXA3 antibody (C-Term)

Catalog No. ABIN3042401

Product Details anti-FOXA3 Antibody

Target: FOXA3 (Forkhead Box A3 (FOXA3))

Binding Specificity: AA 291-324, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FOXA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.

Sequence: ELKLDAPYNF NHPFSINNLM SEQTPAPPKL DVGF

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: forkhead box A3
Protein Name: Hepatocyte nuclear factor 3-gamma

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FOXA3

Target: FOXA3 (Forkhead Box A3 (FOXA3))

Alternative Name: FOXA3 (FOXA3 Products)

Synonyms: FOXA3 antibody, Zffkh1 antibody, fa11c04 antibody, fkd2 antibody, forkhead-2 antibody, wu:fa11c04 antibody, wu:fc37a08 antibody, zf-FKH1 antibody, FKHH3 antibody, HNF3G antibody, TCF3G antibody, HNF3-G antibody, Hnf-3g antibody, Hnf3g antibody, Tcf-3g antibody, Tcf3g antibody, forkhead box A3 antibody, FOXA3 antibody, foxa3 antibody, Foxa3 antibody

Background: Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

Synonyms: FKHH3 antibody|Fork head-related protein FKH H3 antibody|forkhead box A3 antibody|Forkhead box protein A3 antibody|Foxa3 antibody| FOXA3_HUMAN antibody|hepatic nuclear factor-3-beta antibody|hepatocyte nuclear factor 3 antibody|hepatocyte nuclear factor 3 gamma antibody|Hepatocyte nuclear factor 3-gamma antibody|HNF-3-gamma antibody|HNF-3G antibody|HNF3B antibody|HNF3G antibody|TCF-3G antibody|TCF3G antibody|Transcription factor 3G antibody

Gene ID: 3171

UniProt: P55318

Pathways: Carbohydrate Homeostasis