FMO2 antibody (N-Term)

Catalog No. ABIN3042397

Product Details anti-FMO2 Antibody

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Binding Specificity: AA 78-115, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FMO2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2(FMO2) detection. Tested with WB in Human.

Sequence: FPNFLHNSKL LEYFRIFAKK FDLLKYIQFQ TTVLSVRK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2(FMO2) detection. Tested with WB in Human.
Gene Name: flavin containing monooxygenase 2
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK), different from the related mouse and rat sequences by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FMO2

Target: FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))

Alternative Name: FMO2 (FMO2 Products)

Synonyms: FMO 1B1 antibody, FMO 2 antibody, FMO1B1 antibody, 2310008D08Rik antibody, 2310042I22Rik antibody, AW107733 antibody, MGC68715 antibody, FMO4 antibody, FMO2 antibody, flavin containing monooxygenase 2 antibody, flavin containing monooxygenase 2 L homeolog antibody, FMO2 antibody, Fmo2 antibody, fmo2.L antibody

Background: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.

Synonyms: 2310008D08Rik antibody|2310042I22Rik antibody|AW107733 antibody|Dimethylaniline monooxygenase [N oxide forming] 2 antibody| Dimethylaniline monooxygenase [N-oxide-forming] 2 antibody|Dimethylaniline oxidase 2 antibody|Flavin containing monooxygenase 2 (non functional) antibody|Flavin containing monooxygenase 2 antibody|FLJ40826 antibody|FMO 1B1 antibody|FMO 2 antibody|FMO antibody|FMO pulmonary antibody|FMO1B1 antibody|FMO2 antibody|FMO2_HUMAN antibody|MGC28212 antibody|OTTMUSP00000028686 antibody|OTTMUSP00000028687 antibody|Pulmonary flavin containing monooxygenase 2 antibody|Pulmonary flavin-containing monooxygenase 2 antibody

Gene ID: 2327

UniProt: Q99518