EPH Receptor B1 antibody (N-Term)

Catalog No. ABIN3042375

Product Details anti-EPH Receptor B1 Antibody

Target: EPH Receptor B1 (EPHB1)

Binding Specificity: AA 56-88, N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EPH Receptor B1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.

Sequence: RTYQVCNVFE PNQNNWLLTT FINRRGAHRI YTE

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1(EPHB1) detection. Tested with WB, IHC-P in Human.
Gene Name: EPH receptor B1
Protein Name: Ephrin type-B receptor 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE) , identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for EPH Receptor B1

Target: EPH Receptor B1 (EPHB1)

Alternative Name: EPHB1 (EPHB1 Products)

Synonyms: ELK antibody, EPHT2 antibody, Hek6 antibody, NET antibody, ephb1-a antibody, xek antibody, Xek antibody, MGC89790 antibody, EPHB1 antibody, CEK6 antibody, EK6 antibody, 9330129L11 antibody, AW488255 antibody, C130099E04Rik antibody, Cek6 antibody, ENSMUSG00000074119 antibody, Elk antibody, Elkh antibody, Net antibody, Ephb2 antibody, Erk antibody, elk antibody, EPH receptor B1 antibody, EPH receptor B1 S homeolog antibody, ephrin type-B receptor 1 antibody, Eph receptor B1 antibody, EPHB1 antibody, ephb1.S antibody, ephb1 antibody, LOC100467687 antibody, Ephb1 antibody

Background: Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Synonyms: Cek 6 antibody|EK6 antibody|ELK antibody|Elkh antibody|EPH receptor B1 antibody|Eph tyrosine kinase 2 antibody|EPH-like kinase 6 antibody|Ephb1 antibody|EPHB1_HUMAN antibody|Ephrin type B receptor 1 antibody|Ephrin type-B receptor 1 antibody|EPHT2 antibody|HEK 6 antibody|HEK6 antibody|NET antibody|Neuronally-expressed EPH-related tyrosine kinase antibody|soluble EPHB1 variant 1 antibody| Tyrosine protein kinase receptor EPH 2 antibody|Tyrosine-protein kinase receptor EPH-2 antibody

Gene ID: 2047

UniProt: P54762

Pathways: RTK Signaling