Crossover junction endonuclease EME1 (EME1) (AA 520-561), (C-Term) antibody

Catalog No. ABIN3042370

Product Details

Target: Crossover junction endonuclease EME1 (EME1)

Binding Specificity: AA 520-561, C-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1(EME1) detection. Tested with WB, IHC-P in Human,Rat.

Sequence: DKERQNLLAD IQVRRGEGVT STSRRIGPEL SRRIYLQMTT LQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1(EME1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: essential meiotic structure-specific endonuclease 1
Protein Name: Crossover junction endonuclease EME1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ), different from the related mouse sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details

Target: Crossover junction endonuclease EME1 (EME1)

Alternative Name: EME1 (EME1 Products)

Synonyms: 6820428D13 antibody, essential meiotic structure-specific endonuclease 1 antibody, Eme1 antibody

Background: Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.

Synonyms: 6820428D13 antibody|Crossover junction endonuclease EME1 antibody|EC 3.1.22.- antibody|EME1 antibody|Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe) antibody|EME1, S. pombe, homolog of, 1 antibody|EME1_HUMAN antibody|essential meiotic endonuclease 1 homolog 1 (S pombe) antibody|Essential Meiotic Endonuclease 1 Homolog 1 antibody|essential meiotic endonuclease 1 homolog 2 antibody|Essential meiotic endonuclease 1, S. pombe, homolog of, 1 antibody|FLJ31364 antibody|hMMS4 antibody|homolog of yeast EME1 endonuclease antibody|MGC106543 antibody|MMS4 antibody|MMS4 homolog antibody|MMS4L antibody

Gene ID: 146956