Villin 1 antibody (C-Term)

Catalog No. ABIN3042343

Product Details anti-Villin 1 Antibody

Target: Villin 1 (VIL1)

Binding Specificity: AA 770-799, C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Villin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequence: EQLVNKPVEE LPEGVDPSRK EEHLSIEDFT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: villin 1
Protein Name: Villin-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for Villin is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Villin 1

Target: Villin 1 (VIL1)

Alternative Name: VIL1 (VIL1 Products)

Synonyms: D2S1471 antibody, VIL antibody, Vil antibody, vil1 antibody, MGC64339 antibody, VIL1 antibody, vil1l antibody, zgc:55779 antibody, villin 1 antibody, villin 1 S homeolog antibody, VIL1 antibody, Vil1 antibody, vil1.S antibody, vil1 antibody

Background: Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed, they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

Synonyms: D2S1471 antibody|OTTHUMP00000164145 antibody|VIL antibody|VIL1 antibody|VILI_HUMAN antibody|Villin 1 antibody|Villin-1 antibody|Villin1 antibody

Gene ID: 7429

UniProt: P09327

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization