Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ATP2A2 antibody (N-Term)

ATP2A2 Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3030067
  • Target See all ATP2A2 Antibodies
    ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
    Binding Specificity
    • 8
    • 7
    • 7
    • 6
    • 6
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 53
    • 28
    • 28
    • 6
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 52
    • 1
    • 1
    Rabbit
    Clonality
    • 45
    • 9
    Polyclonal
    Conjugate
    • 26
    • 5
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This ATP2A2 antibody is un-conjugated
    Application
    • 36
    • 23
    • 12
    • 6
    • 6
    • 5
    • 3
    • 2
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity
    Immunogen
    An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.
    Isotype
    IgG
    Top Product
    Discover our top product ATP2A2 Primary Antibody
  • Application Notes
    The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
    Alternative Name
    ATP2A2 (ATP2A2 Products)
    Synonyms
    atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, ATP2A2 antibody, ATP2B antibody, DAR antibody, DD antibody, SERCA2 antibody, SERCA2A antibody, ATP2 antibody, Serca2 antibody, SercaII antibody, 9530097L16Rik antibody, D5Wsu150e antibody, SERCA2B antibody, mKIAA4195 antibody, atp2a2 antibody, zgc:55380 antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antibody, atp2a1.S antibody, ATP2A2 antibody, Atp2a2 antibody, atp2a2a antibody
    Background
    SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
    Gene ID
    488
    Pathways
    Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process
You are here:
Support