An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
ACTH
Reactivity: Human, Rat
ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC
Host: Rabbit
Polyclonal
unconjugated
Application Notes
The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL
Restrictions
For Research Use only
Buffer
0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Storage
-20 °C
Storage Comment
After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.