ZNF566 antibody (Middle Region)
-
- Target See all ZNF566 Antibodies
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
-
Binding Specificity
- Middle Region
- Reactivity
- Human, Cow, Horse, Rat, Dog, Pig, Rabbit, Guinea Pig, Mouse, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZNF566 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI
- Predicted Reactivity
- Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%
- Characteristics
- This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.
- Purification
- Affinity Purified
- Immunogen
- The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI
- Top Product
- Discover our top product ZNF566 Primary Antibody
-
anti-Zinc Finger Protein 566 (ZNF566) (AA 110-138), (N-Term) antibody
ZNF566 Reactivity: Human WB Host: Rabbit Polyclonal RB27573 unconjugated
anti-Zinc Finger Protein 566 (ZNF566) (C-Term) antibodyZNF566 Reactivity: Human, Cow, Horse, Rabbit WB Host: Rabbit Polyclonal unconjugated
anti-Zinc Finger Protein 566 (ZNF566) (AA 143-192) antibodyZNF566 Reactivity: Human, Cow, Horse, Monkey WB Host: Rabbit Polyclonal unconjugated
anti-Zinc Finger Protein 566 (ZNF566) (Middle Region) antibodyZNF566 Reactivity: Human, Cow WB Host: Rabbit Polyclonal unconjugated
anti-Zinc Finger Protein 566 (ZNF566) (Middle Region) antibodyZNF566 Reactivity: Human, Cow, Horse, Rat, Dog, Pig, Rabbit WB Host: Rabbit Polyclonal unconjugated
anti-Zinc Finger Protein 566 (ZNF566) (Middle Region) antibodyZNF566 Reactivity: Human, Cow, Horse, Rat, Dog, Pig WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- Optimal working dilutions should be determined experimentally by the investigator.
- Comment
-
Antigen size: 386 AA
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freeze-thaw cycles.
- Storage
- -20 °C
- Storage Comment
- For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
-
- Target
- ZNF566 (Zinc Finger Protein 566 (ZNF566))
- Alternative Name
- Zfp566 (ZNF566 Products)
- Synonyms
- ZNF420 antibody, RGD1563239 antibody, zinc finger protein 566 antibody, ZNF566 antibody, Zfp566 antibody
- Background
-
The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386 - Molecular Weight
- 45 kDa
- Gene ID
- 502316
- NCBI Accession
- NM_001134726, NP_001128198
- UniProt
- B2RZ94
-
