HKDC1 antibody (AA 102-136)

Catalog No. ABIN2741387

Product Details anti-HKDC1 Antibody

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Binding Specificity: AA 102-136

Reactivity: Human, Chimpanzee, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HKDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HKDC1(102-136aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for HKDC1

Target: HKDC1 (Hexokinase Domain Containing 1 (HKDC1))

Alternative Name: HKDC1 (HKDC1 Products)

Synonyms: cb370 antibody, sb:cb370 antibody, HKDC1 antibody, BC016235 antibody, hexokinase domain containing 1 antibody, putative hexokinase HKDC1 antibody, hkdc1 antibody, HKDC1 antibody, LOC100088018 antibody, Hkdc1 antibody

Background: Name/Gene ID: HKDC1

Synonyms: HKDC1, Putative hexokinase HKDC1, Hexokinase domain containing 1

Gene ID: 80201