VEGFA antibody

Catalog No. ABIN2629817

Product Details anti-VEGFA Antibody

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reactivity: Human, Rat, Mouse, Pig, Dog, Rabbit, Chicken, Cow, Guinea Pig, Sheep, Horse, Monkey, Cat, Donkey, Goat, Hamster

Host: Goat

Clonality: Polyclonal

Conjugate: This VEGFA antibody is un-conjugated

Application: Western Blotting (WB), Immunofluorescence (IF)

Specificity: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Purification: Immunoaffinity purified

Immunogen: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotype: IgG

Application Details

Application Notes: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C,-20 °C

Storage Comment: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Target Details for VEGFA

Target: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Alternative Name: VEGFA / VEGF (VEGFA Products)

Background: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

Gene ID: 7422

UniProt: P15692

Pathways: RTK Signaling, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling