Integrin alpha 3a antibody (Cytoplasmic Domain)

Catalog No. ABIN2295550

Product Details anti-Integrin alpha 3a Antibody

Target: Integrin alpha 3a

Binding Specificity: Cytoplasmic Domain

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Integrin alpha 3a antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunochromatography (IC)

Sequence: CRTRALYEAK RQKAEMKSQP SETERLTDDY

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: Integrin alpha 3A

Purification: Purified by Protein G affinity chromatography.

Immunogen: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Clone: 29A3

Isotype: IgG1

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Supplied as a liquid in PBS, pH 7.2, 0.09 % sodium azide. No stabilizing proteins added.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for Integrin alpha 3a

Target: Integrin alpha 3a

Abstract: Integrin alpha 3a Products