NMS antibody (AA 70-103)
-
- Target See all NMS Antibodies
- NMS (Neuromedin S (NMS))
-
Binding Specificity
- AA 70-103
-
Reactivity
- Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NMS antibody is un-conjugated
-
Application
- ELISA
- Specificity
- Mouse Neuromedin S.
- Purification
- Protein A purified
- Immunogen
-
Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).
Type of Immunogen: Synthetic peptide - Isotype
- IgG
- Top Product
- Discover our top product NMS Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
-
Target Species of Antibody: Mouse
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- PBS
- Concentration
- Lot specific
- Buffer
- Lyophilized from PBS, pH 7
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.
-
- Target
- NMS (Neuromedin S (NMS))
- Alternative Name
- NMS (NMS Products)
- Synonyms
- AB164466 antibody, neuromedin S antibody, NMS antibody, nms antibody, Nms antibody
- Background
-
Name/Gene ID: NMS
Synonyms: NMS, FLGRACILE, Neuromedin-S, Neuromedin S, PTD, BJS - Gene ID
- 129521
- UniProt
- Q5H8A3
-