SRA1 antibody (AA 519-556)

Catalog No. ABIN1742561

Product Details anti-SRA1 Antibody

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Binding Specificity: AA 519-556

Reactivity: Human, Rat, Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This SRA1 antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Specificity: Specific for Sra 1

Cross-Reactivity (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Purification: purified IgG. Azide was added before lyophilization.

Immunogen: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Clone: 30A4

Isotype: IgG1

Application Details

Application Notes: WB: 1 : 100 up to 1 : 2000 (AP staining)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: For reconstitution add 100 µL H2O to get a 1mg/ml solution of antibody in PBS. Then aliquot and store at -20 °C until use.

Buffer: PBS, 0.02% sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Do not store diluted antibody solutions unless you add detergent or carrier proteins such as goat serum, BSA or others. IgG sticks to glass and plastic. Any IgG solution below 0.1 mg/mL protein will quickly adsorb and denature and thus loose activity! Repetitive freeze-thawing of dilute purified IgG is almost certain to lead to substantial losses.

Storage: -20 °C

Storage Comment: Unlabeled antibodies are stable in this form without loss of quality at ambient temperatures for several weeks or even months. They can be stored at 4 °C for several years.

References for anti-SRA1 antibody (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." in: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." in: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Target Details for SRA1

Target: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Alternative Name: Sra 1 (SRA1 Products)

Synonyms: SRA antibody, SRAP antibody, STRAA1 antibody, pp7684 antibody, AA959952 antibody, Sra antibody, Srap antibody, Straa1 antibody, Strra1 antibody, zgc:86613 antibody, steroid receptor RNA activator 1 antibody, steroid receptor RNA activator 1 S homeolog antibody, cytoplasmic FMR1 interacting protein 1 antibody, SRA1 antibody, Sra1 antibody, sra1 antibody, sra1.S antibody, CYFIP1 antibody

Background: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development