Ataxin 1 antibody (AA 164-197) (Biotin)

Catalog No. ABIN1741208

Product Details anti-Ataxin 1 Antibody (Biotin)

Target: Ataxin 1 (ATXN1)

Binding Specificity: AA 164-197

Reactivity: Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This Ataxin 1 antibody is conjugated to Biotin

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Specificity: Detects ~85 kDa.

Cross-Reactivity: Human, Mouse, Rat

Purification: Protein G Purified

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Clone: S76-8

Isotype: IgG2b

Application Details

Application Notes:

• WB (1:1000)
• ICC/IF (1:100)
• optimal dilutions for assays should be determined by the user.

Comment:

1 μg/ml of ABIN1741208 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Storage Comment: Conjugated antibodies should be stored at 4°C

Target Details for Ataxin 1

Target: Ataxin 1 (ATXN1)

Alternative Name: Ataxin 1 (ATXN1 Products)

Synonyms: ATX1 antibody, D6S504E antibody, SCA1 antibody, ATXN1 antibody, ataxin 1b antibody, atxn1 antibody, 2900016G23Rik antibody, Atx1 antibody, C85907 antibody, ENSMUSG00000074917 antibody, Gm10786 antibody, Sca1 antibody, CG4547 antibody, Dmel\\CG4547 antibody, dAtx-1 antibody, dAtx1 antibody, sca1 antibody, ataxin 1 antibody, ataxin 1b antibody, Ataxin 1 antibody, ATXN1 antibody, atxn1b antibody, Atxn1 antibody, Atx-1 antibody

Background: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.

Gene ID: 20238

NCBI Accession: NP_001186233

UniProt: P54254

Pathways: Synaptic Membrane