Ataxin 1 antibody (AA 164-197) (Atto 594)
-
- Target See all Ataxin 1 (ATXN1) Antibodies
- Ataxin 1 (ATXN1)
-
Binding Specificity
- AA 164-197
-
Reactivity
- Mouse
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This Ataxin 1 antibody is conjugated to Atto 594
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunoprecipitation (IP), Immunocytochemistry (ICC)
- Specificity
- Detects ~85 kDa.
- Cross-Reactivity
- Human, Mouse, Rat
- Purification
- Protein G Purified
- Immunogen
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
- Clone
- S76-8
- Isotype
- IgG2b
- Top Product
- Discover our top product ATXN1 Primary Antibody
-
-
- Application Notes
-
- WB (1:1000)
- ICC/IF (1:100)
- optimal dilutions for assays should be determined by the user.
- Comment
-
1 μg/ml of ABIN1741201 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide, Storage buffer may change when conjugated
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C
- Storage Comment
- Conjugated antibodies should be stored at 4°C
-
- Target
- Ataxin 1 (ATXN1)
- Alternative Name
- Ataxin 1 (ATXN1 Products)
- Synonyms
- ATX1 antibody, D6S504E antibody, SCA1 antibody, ATXN1 antibody, ataxin 1b antibody, atxn1 antibody, 2900016G23Rik antibody, Atx1 antibody, C85907 antibody, ENSMUSG00000074917 antibody, Gm10786 antibody, Sca1 antibody, CG4547 antibody, Dmel\\CG4547 antibody, dAtx-1 antibody, dAtx1 antibody, sca1 antibody, ataxin 1 antibody, ataxin 1b antibody, Ataxin 1 antibody, ATXN1 antibody, atxn1b antibody, Atxn1 antibody, Atx-1 antibody
- Background
- Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
- Gene ID
- 20238
- NCBI Accession
- NP_001186233
- UniProt
- P54254
- Pathways
- Synaptic Membrane
-