SNF8 antibody (N-Term)
-
- Target See all SNF8 Antibodies
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Cow, Dog, Zebrafish (Danio rerio), Xenopus laevis, Chicken
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SNF8 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Sequence
- MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
- Cross-Reactivity (Details)
- Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human
- Purification
- Purified on peptide immunoaffinity column
- Immunogen
- The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30
- Top Product
- Discover our top product SNF8 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 50 μL of distilled water
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Expiry Date
- 12 months
-
- Target
- SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))
- Alternative Name
- Vacuolar-Sorting Protein SNF8 (SNF8 Products)
- Synonyms
- d11moh34 antibody, vps22 antibody, Dot3 antibody, EAP30 antibody, VPS22 antibody, D11moh34 antibody, RGD1310144 antibody, D11Moh34 antibody, D11MOH34 antibody, zgc:101578 antibody, SNF8, ESCRT-II complex subunit antibody, eap30 subunit of ell complex, putative antibody, EAP30 subunit of ELL complex antibody, SNF8, ESCRT-II complex subunit S homeolog antibody, SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae) antibody, snf8 antibody, TA17290 antibody, TVAG_107410 antibody, Bm1_05145 antibody, SNF8 antibody, Snf8 antibody, snf8.S antibody
- Background
- ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22
- Gene ID
- 11267
- NCBI Accession
- NP_009172
-